Cell and Material Specific Dual-Functional Peptides for Enhancing Mesenchymal Stem Cell Migration for Bone Tissue Engineering

Links

URL: https://hdl.handle.net/2027.42/176570

Abstract

Millions of bone grafting procedures are performed annually to repair bone defects. While autografts and allografts are used clinically for such purposes, their limitations have motivated research into synthetic graft materials. Although numerous biocompatible materials have been developed, lack of bioactivity often results in suboptimal results. The use of bioactive peptides on the surface of a material can help create an interface between materials and specific cells in living tissue. Using phage-display technology, a dual-functional peptide DPI-VTK (GGDPIYALSWSGMAGGGSVTKHLNQISQSY) that contains both a mesenchymal stem cell (MSC) binding domain DPIYALSWSGMA (DPI) and a hydroxyapatite binding domain VTKHLNQISQSY (VTK) was developed. Because of the importance of adhesion molecules for cellular migration, such a peptide could not only enhance the adhesion of MSCs to hydroxyapatite but could also promote the specific migration of host MSCs, bypassing the need for cell transplantation. Additionally, this peptide could be combined with BMP peptides to create dual-functional osteoconductive and osteoinductive interfaces that encourage the homing of MSCs along with their subsequent differentiation. The overall hypothesis of this dissertation is that dual-functional MSC and apatite binding peptide DPI-VTK along with a dual-functional BMP and apatite binding peptide KIP-VTK will increase bone regeneration with mineralized scaffolds by increasing the migration of MSCs and their subsequent osteogenic differentiation.

This dissertation proposed the following aims to test this hypothesis: 1) determine if peptide DPI-VTK can increase MSC specific migration in vitro and in vivo to support bone formation; 2) determine if peptide DPI-VTK has a synergistic effect with BMP derived peptide KIP-VTK to increase osteogenic differentiation.

In transwell assays, human iPS-MSCs showed significantly greater migration (6-fold increase) over no peptide controls when DPI-VTK was used as a chemoattractant. Non-MSC controls such as MC3T3 cells and mouse dermal fibroblasts (MDFs) showed no statistically significant effect on migration from DPI-VTK. When MSCs were incubated in transwells with peptides DPI-VTK, DPI, and VTK, migration was equivalent for DPI-VTK and DPI, while VTK had no difference from the control, demonstrating that the DPI peptide, but not VTK, can induce migration. Primary calvarial cells had a significant increase in migration (>2-fold increase) when exposed to DPI-VTK. After 1 week in-vivo, immunohistochemical staining for MSC markers demonstrated increased migration of CD90 and CD200 positive cells. After 8 weeks, micro-CT demonstrated a significant increase in regenerated bone volume in the DPI-VTK group versus no peptide control. Coupling peptide VTK to BMP derived peptide KIP increased absorption to mineral. When co-absorbed with DPI-VTK, KIP-VTK failed to generate a synergistic effect on osteogenic differentiation.

In conclusion, this research has demonstrated that targeting specific cell populations with cell and material binding peptides such as DPI-VTK is possible. Due to the widespread use of hydroxyapatite-based biomaterials in craniofacial bone grafting, DPI-VTK could be useful clinically for enhancing their ability to promote migration of host MSCs. Developing dualfunctional material that both recruits host cells and induces differentiation could be a key strategy for regenerating large-volume defects without the need for exogenous cells or autografts.

Cited Works (16)

Year	Entry
2000	Jäger I, Fratzl P. Mineralized collagen fibrils: a mechanical model with a staggered arrangement of mineral particles. Biophys J. October 2000;79(4):1737-1746.
2014	Fonseca H, Moreira-Gonçalves D, Coriolano H-JA, Duarte JA. Bone quality: the determinants of bone strength and fragility. Sports Med. January 2014;44(1):37-53.
2002	Everts V, Delaissé JM, Korper W, Jansen DC, Tigchelaar-Gutter W, Saftig P, Beertsen W. The bone lining cell: its role in cleaning Howship's lacunae and initiating bone formation. J Bone Miner Res. January 2002;17(1):77-90.
1989	Miller SC, de Saint-Georges L, Bowman BM, Jee WSS. Bone lining cells: structure and function. Scanning Microsc. 1989;3(3):953-961.
2004	McBeath R, Pirone DM, Nelson CM, Bhadriraju K, Chen CS. Cell shape, cytoskeletal tension, and RhoA regulate stem cell lineage commitment. Dev Cell. April 2004;6(4):483-495.
2003	Rubin MA, Jasiuk I, Taylor J, Rubin J, Ganey T, Apkarian RP. TEM analysis of the nanostructure of normal and osteoporotic human trabecular bone. Bone. March 2003;32(3):270-282.
2008	Anderson JM, Rodriguez A, Chang DT. Foreign body reaction to biomaterials. Semin Immunol. April 2008;20(2):86-100.
2003	Hersel U, Dahmen C, Kessler H. RGD modified polymers: biomaterials for stimulated cell adhesion and beyond. Biomaterials. November 2003;24(24):4385-4415.
1996	Jepsen KJ, Goldstein SA, Kuhn JL, Schaffler MB, Bonadio J. Type‐I collagen mutation compromises the post‐yield behavior of Mov13 long bone. J Orthop Res. May 1996;14(3):493-499.
2000	Noble BS, Reeve J. Osteocyte function, osteocyte death and bone fracture resistance. Mol Cell Endocrinol. January 25, 2000;159(1-2):7-13.
2007	Tan SD, de Vries TJ, Kuijpers-Jagtman AM, Semeins CM, Everts V, Klein-Nulend J. Osteocytes subjected to fluid flow inhibit osteoclast formation and bone resorption. Bone. November 2007;41(5):745-751.
2006	Engler AJ, Sen S, Sweeney HL, Discher DE. Matrix elasticity directs stem cell lineage specification. Cell. August 25, 2006;126(4):P677-P689.
2008	You L, Temiyasathit S, Lee P, Kim CH, Tummala P, Yao W, Kingery W, Malone AM, Kwon RY, Jacobs CR. Osteocytes as mechanosensors in the inhibition of bone resorption due to mechanical loading. Bone. January 2008;42(1):172-179.
2018	Reznikov N, Bilton M, Lari L, Stevens MM, Kröger R. Fractal-like hierarchical organization of bone begins at the nanoscale. Science. May 4, 2018;360(6388):eaao2189.
2006	Robling AG, Castillo AB, Turner CH. Biomechanical and molecular regulation of bone remodeling. Annu Rev Biomed Eng. 2006;8:455-498.
1996	McKee MD, Nanci A. Osteopontin at mineralized tissue interfaces in bone, teeth, and osseointegrated implants: ultrastructural distribution and implications for mineralized tissue formation, turnover, and repair. Microsc Res Tech. February 1996;33(2):141-164.